Proteopedia

User:Michael Strong/H1N1/PB2/MSA: Difference between revisions

Newer edit →
New page: == H1N1 Swine Flu Multiple Sequence Alignment of PB2 Protein, 31 sequences== <pre> gi|229892698_A/Canada-NS/RV153 MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50 gi|237511929_...
 
No edit summary
Line 1: Line 1:
== H1N1 Swine Flu Multiple Sequence Alignment of PB2 Protein, 31 sequences==
== H1N1 Swine Flu Multiple Sequence Alignment of PB2 Protein, 31 sequences==
{|
|Protein
|Polymorphism
|Strain with Polymorphism
|Number of Strains with Polymorphism
|----
|PB2
|I30V
|gi|229892696_A/Canada-AB/RV153
|1
|----
|PB2
|N82S
|gi|229484025_A/Mexico/InDRE448
|all others
|----
|PB2
|H151Q
|gi|237624321_A/swine/Alberta/O
|1
|----
|PB2
|D161N
|gi|227831783_A/California/06/2
|1
|----
|PB2
|V267I
|gi|229783414_A/New_York/1682/2
|1
|----
|PB2
|S324R
|gi|237624321_A/swine/Alberta/O
|1
|----
|PB2
|H432Y
|gi|237624321_A/swine/Alberta/O
|1
|----
|PB2
|L464M
|gi|229892692_A/Mexico/InDRE411
|1
|----
|PB2
|K526R
|gi|229892698_A/Canada-NS/RV153
|5
|----
|PB2
|G698D
|gi|227831783_A/California/06/2
|1
|----
|}




Retrieved from "https://proteopedia.openfox.io/w/User:Michael_Strong/H1N1/PB2/MSA"