User:Eric Martz/Cavities tests: Difference between revisions
Eric Martz (talk | contribs) x |
Eric Martz (talk | contribs) x |
||
| Line 85: | Line 85: | ||
(Copied from Protein Explorer's sequence display.) | (Copied from Protein Explorer's sequence display.) | ||
Below is the alignment of dnaC with 2QGZ according to TargetDB (see above). | Below is the alignment of full-length dnaC with 2QGZ according to TargetDB (see above). Note that the homology model begins with residue 55 of dnaC, indicated with > below. | ||
<pre> | <pre> | ||
ID: DR58 Center: NESGC | ID: DR58 Center: NESGC | ||
| Line 96: | Line 96: | ||
40 50 60 70 80 90 | 40 50 60 70 80 90 | ||
40 50 | 40 50 > 60 70 80 90 | ||
Query IRSAALERENRAMKMQRTFNRSGIRPLHQNCSFENYRVECEGQMNALSKARQYVEEF-DG | Query IRSAALERENRAMKMQRTFNRSGIRPLHQNCSFENYRVECEGQMNALSKARQYVEEF-DG | ||
+++ L + ++ +++ ++ ++ +++ + + V+ ++M+A+S ++VE++ ++ | +++ L + ++ +++ ++ ++ +++ + + V+ ++M+A+S ++VE++ ++ | ||