1stp: Difference between revisions

Proteopedia Page Contributors and Editors (what is this?)Proteopedia Page Contributors and Editors (what is this?)

@@ Line 18: / Line 18: @@
 ==About this Structure==
-STP is a [[Single protein]] structure of sequence from [http://en.wikipedia.org/wiki/Streptomyces_avidinii Streptomyces avidinii].
+STP is a [[Single protein]] structure of sequence from [http://en.wikipedia.org/wiki/Streptomyces_avidinii Streptomyces avidinii]. Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=1STP OCA].
-{| class="toccolours collapsible collapsed" width=80%
-|-
-! colspan="2" | Sequence and Crystal Information |-
-|Sequence||DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
-|}
-Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=1STP OCA].
 ==Reference==
@@ Line 34: / Line 28: @@
 [[Category: biotin binding protein]]
-''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Sat Mar 29 23:15:18 2008''
+''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Sat Mar 29 23:17:03 2008''