1stp: Difference between revisions
No edit summary |
No edit summary |
||
| Line 7: | Line 7: | ||
|ACTIVITY= | |ACTIVITY= | ||
|GENE= | |GENE= | ||
|DOMAIN=<span class='plainlinks'>[http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid= Avidin]</span> | |||
|RESOURCES=<span class='plainlinks'>[http://oca.weizmann.ac.il/oca-docs/fgij/fg.htm?mol=1stp FirstGlance], [http://oca.weizmann.ac.il/oca-bin/ocaids?id=1stp OCA], [http://www.ebi.ac.uk/pdbsum/1stp PDBsum], [http://www.fli-leibniz.de/cgi-bin/ImgLib.pl?CODE=1kfv JenaLib], [http://www.rcsb.org/pdb/explore.do?structureId=1stp RCSB]</span> | |||
}} | }} | ||
| Line 16: | Line 18: | ||
==About this Structure== | ==About this Structure== | ||
1STP is a [[Single protein]] structure of sequence from [http://en.wikipedia.org/wiki/Streptomyces_avidinii Streptomyces avidinii]. Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=1STP OCA]. | 1STP is a [[Single protein]] structure of sequence from [http://en.wikipedia.org/wiki/Streptomyces_avidinii Streptomyces avidinii]. | ||
{| class="toccolours collapsible collapsed" width=80% | |||
|- | |||
! colspan="2" | Sequence and Crystal Information |- | |||
|Sequence||DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ | |||
|} | |||
Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=1STP OCA]. | |||
==Reference== | ==Reference== | ||
| Line 24: | Line 32: | ||
[[Category: Salemme, F R.]] | [[Category: Salemme, F R.]] | ||
[[Category: Weber, P C.]] | [[Category: Weber, P C.]] | ||
[[Category: biotin binding protein]] | [[Category: biotin binding protein]] | ||
''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on | ''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Sat Mar 29 23:15:18 2008'' | ||